PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe2G274900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family TALE
Protein Properties Length: 302aa    MW: 34177.9 Da    PI: 4.5415
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe2G274900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.1e-092362682355
                        SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
           Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                        +yp++e++ +LA+ +gL+++q  +WF N+R ++
  Aqcoe2G274900.1.p 236 PYPTEEDKSKLAEMTGLDQKQLNNWFINQRKRH 268
                        8*****************************885 PP

2ELK377e-13188209122
                ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                        ELK++L+rKYsgyL+sLk+ F+
  Aqcoe2G274900.1.p 188 ELKDMLMRKYSGYLSSLKKDFL 209
                        9********************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.1E-204185IPR005540KNOX1
PfamPF037906.4E-214383IPR005540KNOX1
SMARTSM012561.4E-2290141IPR005541KNOX2
PfamPF037914.5E-2393140IPR005541KNOX2
PROSITE profilePS5121310.51188208IPR005539ELK domain
PfamPF037894.6E-10188209IPR005539ELK domain
SMARTSM011887.9E-7188209IPR005539ELK domain
PROSITE profilePS5007112.698208271IPR001356Homeobox domain
SMARTSM003894.3E-12210275IPR001356Homeobox domain
SuperFamilySSF466891.54E-18210278IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-26213273IPR009057Homeodomain-like
CDDcd000862.00E-11220272No hitNo description
PfamPF059201.4E-17228267IPR008422Homeobox KN domain
PROSITE patternPS000270246269IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MEDLYNRFID VTPTSENSSS SGFLLHQFQT NNESGSEMMS DLIKAQIASH PQYPTLVSAY  60
IDCQKIGAPP EVASLFEEIS RESRPSSNSF NSEIGDDPEL DEFMESYCKI LVGYKEELTK  120
SFDEAATFLS KIETQLNHIC KGMSTTTISG NYDQSDETVG SSEEELSCGE KESLESQESS  180
SLRSGDQELK DMLMRKYSGY LSSLKKDFLK KRKKGKLPKD ARTTLLDWWN SHYRWPYPTE  240
EDKSKLAEMT GLDQKQLNNW FINQRKRHWR PSEDMRFAVI EGVSGGGGSM FYDNPGGNDE  300
L*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1203212LKKDFLKKRK
2209213KKRKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00670PBMTransfer from GRMZM2G087741Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP3315330.0KP331533.1 Aquilegia coerulea KXL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277931.21e-127PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-106KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA5C7Q81e-128A5C7Q8_VITVI; Putative uncharacterized protein
STRINGVIT_14s0060g01180.t011e-128(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-82KNOTTED1-like homeobox gene 6